Pay in 4 interest-free payments of $263.20 Learn more
Ships within 48 hours · Estimated delivery Aug 9 - Aug 14
Expression Region:1-523
AA Sequence:MGYVIMTFSSARMSERRARIIYIWMHLSAYKINFPFVQFPTFFSLFRLQKKAAILIKNPS PFFLFFLFPYRKNSTARTIHQINQAVALVLLCVSHHLTYLPSVPSL
Protein Names:Recommended name: C-8 sterol isomerase EC= 5
Gene Names:Ordered Locus Names:YPN_2465 ORF Names:YP516_2778
Recombinant Brucella suis Lipoprotein signal peptidase(lspA) PCR 8-Strip Tubes Sealing Films & More Expression Region:1-523Size: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Brucella suis (strain ATCC 23445 NCTC 10510) Uniprot NO.: B0CIQ7 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris based buffer,50% glycerol, optimized for this protein Storage: Store at 20, for extended storage, conserve at 20 or 80. Notes: Repeated freezing and thawing is not recommended. Store working
US$ 12.99
US$ 50.00
US$ 17.00
